PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009625550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 326aa    MW: 37128.1 Da    PI: 7.9793
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009625550.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1761e-54181441129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+++yL kkv ++++++  +i +vd++kvePw+Lp k+k +ekewyfF+ rdkky+tg r+nrat++gyWkatgkdke+++ 
  XP_009625550.1  18 LPPGFRFHPTDEELITHYLSKKVVDTDFSA-IAIGDVDMNKVEPWELPWKAKIGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKATGKDKEIFR- 110
                     79*************************999.88***************98999*****************************************. PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +++lvg+kktLvfykgrapkgekt+Wv heyrle
  XP_009625550.1 111 GKSLVGMKKTLVFYKGRAPKGEKTNWVTHEYRLE 144
                     999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-6114168IPR003441NAC domain
PROSITE profilePS5100558.39618168IPR003441NAC domain
PfamPF023656.2E-2819143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MENFSGVIKE DDQQQMELPP GFRFHPTDEE LITHYLSKKV VDTDFSAIAI GDVDMNKVEP  60
WELPWKAKIG EKEWYFFCVR DKKYPTGLRT NRATAAGYWK ATGKDKEIFR GKSLVGMKKT  120
LVFYKGRAPK GEKTNWVTHE YRLEGRLSLH NLPKTAKNDW VICRVFQKTT GGKKIHISGL  180
MQSNSTGNEM GNSLLPPLTA SSPSHVHCFS NFLTAQKSEE NMINYFDTSP NFSALSNPMD  240
IFPRNSLPNT FSWNQTVPFP QPGSFPVQDP VSLRNLLENY GQNMQQSLKK EKEMVSISQE  300
TGLSTDMNTE ITSSVVQQDL DCLWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5761745171NO APICAL MERISTEM PROTEIN
1ut4_B4e-5761745171NO APICAL MERISTEM PROTEIN
1ut7_A4e-5761745171NO APICAL MERISTEM PROTEIN
1ut7_B4e-5761745171NO APICAL MERISTEM PROTEIN
3swm_A5e-5761748174NAC domain-containing protein 19
3swm_B5e-5761748174NAC domain-containing protein 19
3swm_C5e-5761748174NAC domain-containing protein 19
3swm_D5e-5761748174NAC domain-containing protein 19
3swp_A5e-5761748174NAC domain-containing protein 19
3swp_B5e-5761748174NAC domain-containing protein 19
3swp_C5e-5761748174NAC domain-containing protein 19
3swp_D5e-5761748174NAC domain-containing protein 19
4dul_A4e-5761745171NAC domain-containing protein 19
4dul_B4e-5761745171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-58HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009625550.10.0PREDICTED: NAC domain-containing protein 100-like
RefseqXP_016463159.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-130NC100_ARATH; NAC domain-containing protein 100
TrEMBLK4BL870.0K4BL87_SOLLC; Uncharacterized protein
STRINGSolyc03g115850.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-123NAC domain containing protein 100